| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
| Family a.43.1.8: Trafficking protein A-like [140550] (1 protein) |
| Protein Trafficking protein A [140551] (1 species) |
| Species Neisseria gonorrhoeae [TaxId:485] [140552] (2 PDB entries) Uniprot Q5F881 2-70 |
| Domain d2h1of1: 2h1o F:2-65 [145279] Other proteins in same PDB: d2h1oa1, d2h1ob1, d2h1oc1, d2h1od1 automatically matched to 2H1O E:2-69 protein/DNA complex |
PDB Entry: 2h1o (more details), 3 Å
SCOPe Domain Sequences for d2h1of1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h1of1 a.43.1.8 (F:2-65) Trafficking protein A {Neisseria gonorrhoeae [TaxId: 485]}
asvvirnlseathnaikfraraagrsteaeirlildniakaqqtvrlgsmlasigqeigg
vele
Timeline for d2h1of1: