Lineage for d2h1oe1 (2h1o E:2-69)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712590Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 2712591Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 2712750Family a.43.1.8: Trafficking protein A-like [140550] (1 protein)
  6. 2712751Protein Trafficking protein A [140551] (1 species)
  7. 2712752Species Neisseria gonorrhoeae [TaxId:485] [140552] (2 PDB entries)
    Uniprot Q5F881 2-70
  8. 2712753Domain d2h1oe1: 2h1o E:2-69 [145278]
    Other proteins in same PDB: d2h1oa1, d2h1oa2, d2h1ob1, d2h1ob2, d2h1oc1, d2h1oc2, d2h1od1, d2h1od2
    protein/DNA complex

Details for d2h1oe1

PDB Entry: 2h1o (more details), 3 Å

PDB Description: structure of fitab bound to ir36 dna fragment
PDB Compounds: (E:) trafficking protein a

SCOPe Domain Sequences for d2h1oe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h1oe1 a.43.1.8 (E:2-69) Trafficking protein A {Neisseria gonorrhoeae [TaxId: 485]}
asvvirnlseathnaikfraraagrsteaeirlildniakaqqtvrlgsmlasigqeigg
veledvrg

SCOPe Domain Coordinates for d2h1oe1:

Click to download the PDB-style file with coordinates for d2h1oe1.
(The format of our PDB-style files is described here.)

Timeline for d2h1oe1: