Lineage for d2gyke_ (2gyk E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993360Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1993555Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) (S)
    automatically mapped to Pfam PF01320
  5. 1993556Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)
  6. 1993580Protein ImmE9 protein (Im9) [47351] (1 species)
  7. 1993581Species Escherichia coli [TaxId:562] [47352] (18 PDB entries)
  8. 1993583Domain d2gyke_: 2gyk E: [145277]
    Other proteins in same PDB: d2gykb_, d2gykf_
    automated match to d1e0ha_
    protein/DNA complex; complexed with po4, zn; mutant

Details for d2gyke_

PDB Entry: 2gyk (more details), 1.6 Å

PDB Description: crystal structure of the complex of the colicin e9 dnase domain with a mutant immunity protein, imme9 (d51a)
PDB Compounds: (E:) colicin-e9 immunity protein

SCOPe Domain Sequences for d2gyke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gyke_ a.28.2.1 (E:) ImmE9 protein (Im9) {Escherichia coli [TaxId: 562]}
lkhsisdyteaeflqlvtticnadtsseeelvklvthfeemtehpsgsaliyypkegddd
spsgivntvkqwraangksgfkq

SCOPe Domain Coordinates for d2gyke_:

Click to download the PDB-style file with coordinates for d2gyke_.
(The format of our PDB-style files is described here.)

Timeline for d2gyke_: