SCOPe 2.03: Domain d2gyke_: 2gyk E:

Lineage for d2gyke_ (2gyk E:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family)
   automatically mapped to Pfam PF01320

5. Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)

6. Protein ImmE9 protein (Im9) [47351] (1 species)

7. Species Escherichia coli [TaxId:562] [47352] (17 PDB entries)

8. Domain d2gyke_: 2gyk E: [145277]
   Other proteins in same PDB: d2gykb_, d2gykf_
   automated match to d1e0ha_
   protein/DNA complex; complexed with po4, zn; mutant

Details for d2gyke_

PDB Entry: 2gyk, 1.6 Å

PDB Description: crystal structure of the complex of the colicin e9 dnase domain with a mutant immunity protein, imme9 (d51a)

PDB Compounds: (E:) colicin-e9 immunity protein

SCOPe Domain Sequences for d2gyke_:

Sequence; same for both SEQRES and ATOM records:

>d2gyke_ a.28.2.1 (E:) ImmE9 protein (Im9) {Escherichia coli [TaxId: 562]}
lkhsisdyteaeflqlvtticnadtsseeelvklvthfeemtehpsgsaliyypkegddd
spsgivntvkqwraangksgfkq

Timeline for d2gyke_:

• d2gyke_ first appeared in SCOP 1.75, called d2gyke1
  
• d2gyke_ appears in SCOPe 2.02
  
• d2gyke_ appears in SCOPe 2.04
  
• d2gyke_ appears in the current release, SCOPe 2.08