SCOPe 2.07: Domain d2gyka1: 2gyk A:3-85

Lineage for d2gyka1 (2gyk A:3-85)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families)
   automatically mapped to Pfam PF01320

5. Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)

6. Protein ImmE9 protein (Im9) [47351] (1 species)

7. Species Escherichia coli [TaxId:562] [47352] (18 PDB entries)

8. Domain d2gyka1: 2gyk A:3-85 [145276]
   Other proteins in same PDB: d2gykb_, d2gykf_
   protein/DNA complex; complexed with po4, zn; mutant

Details for d2gyka1

PDB Entry: 2gyk, 1.6 Å

PDB Description: crystal structure of the complex of the colicin e9 dnase domain with a mutant immunity protein, imme9 (d51a)

PDB Compounds: (A:) colicin-e9 immunity protein

SCOPe Domain Sequences for d2gyka1:

Sequence; same for both SEQRES and ATOM records:

>d2gyka1 a.28.2.1 (A:3-85) ImmE9 protein (Im9) {Escherichia coli [TaxId: 562]}
lkhsisdyteaeflqlvtticnadtsseeelvklvthfeemtehpsgsaliyypkegddd
spsgivntvkqwraangksgfkq

Timeline for d2gyka1:

• d2gyka1 first appeared in SCOP 1.75
  
• d2gyka1 appears in SCOPe 2.06
  
• d2gyka1 appears in the current release, SCOPe 2.08