Lineage for d2gybt1 (2gyb T:4-86)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985818Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1985989Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
    automatically mapped to Pfam PF01649
  5. 1985990Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 1985991Protein Ribosomal protein S20 [46994] (2 species)
  7. 1985992Species Escherichia coli [TaxId:562] [158365] (26 PDB entries)
    Uniprot P0A7U7 2-86
  8. 1986017Domain d2gybt1: 2gyb T:4-86 [145261]
    Other proteins in same PDB: d2gybb1, d2gybd1, d2gybh1, d2gybi1, d2gybm1, d2gybp1, d2gybq1, d2gybs1
    protein/RNA complex
    protein/RNA complex

Details for d2gybt1

PDB Entry: 2gyb (more details), 15 Å

PDB Description: Structure of the 30S subunit of a SecM-stalled E. coli ribosome complex obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1143
PDB Compounds: (T:) 30S ribosomal subunit protein S20

SCOPe Domain Sequences for d2gybt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gybt1 a.7.6.1 (T:4-86) Ribosomal protein S20 {Escherichia coli [TaxId: 562]}
ksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqaak
glihknkaarhkanltaqinkla

SCOPe Domain Coordinates for d2gybt1:

Click to download the PDB-style file with coordinates for d2gybt1.
(The format of our PDB-style files is described here.)

Timeline for d2gybt1: