Lineage for d2gybs1 (2gyb S:2-80)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186446Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 2186447Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
    automatically mapped to Pfam PF00203
  5. 2186448Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 2186449Protein Ribosomal protein S19 [54572] (2 species)
  7. 2186450Species Escherichia coli [TaxId:562] [160144] (26 PDB entries)
    Uniprot P0A7U3 2-80
  8. 2186475Domain d2gybs1: 2gyb S:2-80 [145260]
    Other proteins in same PDB: d2gybb1, d2gybd1, d2gybh1, d2gybi1, d2gybm1, d2gybp1, d2gybq1, d2gybt1
    protein/RNA complex
    protein/RNA complex

Details for d2gybs1

PDB Entry: 2gyb (more details), 15 Å

PDB Description: Structure of the 30S subunit of a SecM-stalled E. coli ribosome complex obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1143
PDB Compounds: (S:) 30S ribosomal subunit protein S19

SCOPe Domain Sequences for d2gybs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gybs1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]}
rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv
tdemvghklgefaptrtyr

SCOPe Domain Coordinates for d2gybs1:

Click to download the PDB-style file with coordinates for d2gybs1.
(The format of our PDB-style files is described here.)

Timeline for d2gybs1: