![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.39: Ribosomal protein L14 [50192] (1 superfamily) barrel, closed; n=5, S=8, meander |
![]() | Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) ![]() automatically mapped to Pfam PF00238 |
![]() | Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein) |
![]() | Protein Ribosomal protein L14 [50195] (5 species) |
![]() | Species Escherichia coli [TaxId:562] [159078] (29 PDB entries) Uniprot P02411 2-122 |
![]() | Domain d2gyai1: 2gya I:2-122 [145248] Other proteins in same PDB: d2gya11, d2gya31, d2gya32, d2gya51, d2gya52, d2gyab1, d2gyac1, d2gyad1, d2gyaf1, d2gyaf2, d2gyag1, d2gyag2, d2gyah1, d2gyaj1, d2gyak1, d2gyam1, d2gyan1, d2gyao1, d2gyaq1, d2gyas1, d2gyat1, d2gyau1, d2gyaw1, d2gyax1 automatically matched to 2AW4 K:2-122 |
PDB Entry: 2gya (more details), 15 Å
SCOPe Domain Sequences for d2gyai1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gyai1 b.39.1.1 (I:2-122) Ribosomal protein L14 {Escherichia coli [TaxId: 562]} iqeqtmlnvadnsgarrvmcikvlggshrryagvgdiikitikeaiprgkvkkgdvlkav vvrtkkgvrrpdgsvirfdgnacvllnnnseqpigtrifgpvtrelrsekfmkiislape v
Timeline for d2gyai1: