Lineage for d2gyag2 (2gya G:2-72)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2553569Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 2553570Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 2553571Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 2553575Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 2553581Species Escherichia coli [TaxId:562] [160201] (29 PDB entries)
    Uniprot P0A7J7 1-72
  8. 2553610Domain d2gyag2: 2gya G:2-72 [145246]
    Other proteins in same PDB: d2gya11, d2gya31, d2gya32, d2gya51, d2gya52, d2gyab1, d2gyac1, d2gyad1, d2gyaf1, d2gyaf2, d2gyag1, d2gyah1, d2gyai1, d2gyaj1, d2gyak1, d2gyam1, d2gyan1, d2gyao1, d2gyaq1, d2gyas1, d2gyat1, d2gyau1, d2gyaw1, d2gyax1

Details for d2gyag2

PDB Entry: 2gya (more details), 15 Å

PDB Description: Structure of the 50S subunit of a pre-translocational E. coli ribosome obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1056
PDB Compounds: (G:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2gyag2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gyag2 d.47.1.1 (G:2-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]}
kkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitvy
adrsftfvtkt

SCOPe Domain Coordinates for d2gyag2:

Click to download the PDB-style file with coordinates for d2gyag2.
(The format of our PDB-style files is described here.)

Timeline for d2gyag2: