Lineage for d2gyag1 (2gya G:73-140)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695423Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 2695424Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 2695425Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 2695443Species Escherichia coli [TaxId:562] [158349] (29 PDB entries)
    Uniprot P0A7J7 73-141
  8. 2695471Domain d2gyag1: 2gya G:73-140 [145245]
    Other proteins in same PDB: d2gya11, d2gya31, d2gya32, d2gya51, d2gya52, d2gyab1, d2gyac1, d2gyad1, d2gyaf1, d2gyaf2, d2gyag2, d2gyah1, d2gyai1, d2gyaj1, d2gyak1, d2gyam1, d2gyan1, d2gyao1, d2gyaq1, d2gyas1, d2gyat1, d2gyau1, d2gyaw1, d2gyax1

Details for d2gyag1

PDB Entry: 2gya (more details), 15 Å

PDB Description: Structure of the 50S subunit of a pre-translocational E. coli ribosome obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1056
PDB Compounds: (G:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2gyag1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gyag1 a.4.7.1 (G:73-140) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]}
ppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgadieamtrsiegta
rsmglvve

SCOPe Domain Coordinates for d2gyag1:

Click to download the PDB-style file with coordinates for d2gyag1.
(The format of our PDB-style files is described here.)

Timeline for d2gyag1: