Lineage for d2gy9t1 (2gy9 T:4-86)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309866Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2310051Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
    automatically mapped to Pfam PF01649
  5. 2310052Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 2310053Protein Ribosomal protein S20 [46994] (2 species)
  7. 2310054Species Escherichia coli [TaxId:562] [158365] (26 PDB entries)
    Uniprot P0A7U7 2-86
  8. 2310080Domain d2gy9t1: 2gy9 T:4-86 [145239]
    Other proteins in same PDB: d2gy9b1, d2gy9d1, d2gy9h1, d2gy9i1, d2gy9m1, d2gy9p1, d2gy9q1, d2gy9s1

Details for d2gy9t1

PDB Entry: 2gy9 (more details), 15 Å

PDB Description: Structure of the 30S subunit of a pre-translocational E. coli ribosome obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1056
PDB Compounds: (T:) 30S ribosomal subunit protein S20

SCOPe Domain Sequences for d2gy9t1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gy9t1 a.7.6.1 (T:4-86) Ribosomal protein S20 {Escherichia coli [TaxId: 562]}
ksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqaak
glihknkaarhkanltaqinkla

SCOPe Domain Coordinates for d2gy9t1:

Click to download the PDB-style file with coordinates for d2gy9t1.
(The format of our PDB-style files is described here.)

Timeline for d2gy9t1: