![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) ![]() automatically mapped to Pfam PF01649 |
![]() | Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein) this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain |
![]() | Protein Ribosomal protein S20 [46994] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [158365] (26 PDB entries) Uniprot P0A7U7 2-86 |
![]() | Domain d2gy9t1: 2gy9 T:4-86 [145239] Other proteins in same PDB: d2gy9b1, d2gy9d1, d2gy9h1, d2gy9i1, d2gy9m1, d2gy9p1, d2gy9q1, d2gy9s1 |
PDB Entry: 2gy9 (more details), 15 Å
SCOPe Domain Sequences for d2gy9t1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gy9t1 a.7.6.1 (T:4-86) Ribosomal protein S20 {Escherichia coli [TaxId: 562]} ksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqaak glihknkaarhkanltaqinkla
Timeline for d2gy9t1: