Lineage for d2gy9s1 (2gy9 S:2-80)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1644959Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 1644960Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
    automatically mapped to Pfam PF00203
  5. 1644961Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 1644962Protein Ribosomal protein S19 [54572] (2 species)
  7. 1644963Species Escherichia coli [TaxId:562] [160144] (26 PDB entries)
    Uniprot P0A7U3 2-80
  8. 1644988Domain d2gy9s1: 2gy9 S:2-80 [145238]
    Other proteins in same PDB: d2gy9b1, d2gy9d1, d2gy9h1, d2gy9i1, d2gy9m1, d2gy9p1, d2gy9q1, d2gy9t1
    automatically matched to 2AVY S:2-80

Details for d2gy9s1

PDB Entry: 2gy9 (more details), 15 Å

PDB Description: Structure of the 30S subunit of a pre-translocational E. coli ribosome obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1056
PDB Compounds: (S:) 30S ribosomal subunit protein S19

SCOPe Domain Sequences for d2gy9s1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gy9s1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]}
rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv
tdemvghklgefaptrtyr

SCOPe Domain Coordinates for d2gy9s1:

Click to download the PDB-style file with coordinates for d2gy9s1.
(The format of our PDB-style files is described here.)

Timeline for d2gy9s1: