![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
![]() | Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) ![]() |
![]() | Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
![]() | Protein Ribosomal protein S19 [54572] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [160144] (26 PDB entries) Uniprot P0A7U3 2-80 |
![]() | Domain d2gy9s1: 2gy9 S:2-80 [145238] Other proteins in same PDB: d2gy9b1, d2gy9d1, d2gy9h1, d2gy9i1, d2gy9m1, d2gy9p1, d2gy9q1, d2gy9t1 automatically matched to 2AVY S:2-80 |
PDB Entry: 2gy9 (more details), 2 Å
SCOP Domain Sequences for d2gy9s1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gy9s1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]} rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv tdemvghklgefaptrtyr
Timeline for d2gy9s1: