![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Ribosomal protein S17 [50304] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [159088] (26 PDB entries) Uniprot P02373 3-82 |
![]() | Domain d2gy9q1: 2gy9 Q:5-82 [145237] Other proteins in same PDB: d2gy9b1, d2gy9d1, d2gy9h1, d2gy9i1, d2gy9m1, d2gy9p1, d2gy9s1, d2gy9t1 automatically matched to 2AVY Q:3-82 |
PDB Entry: 2gy9 (more details), 2 Å
SCOP Domain Sequences for d2gy9q1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gy9q1 b.40.4.5 (Q:5-82) Ribosomal protein S17 {Escherichia coli [TaxId: 562]} rtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveirecr plsktkswtlvrvvekav
Timeline for d2gy9q1: