Lineage for d2gy9m1 (2gy9 M:1-114)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752104Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 1752105Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 1752106Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
    automatically mapped to Pfam PF00416
  6. 1752107Protein Ribosomal protein S13 [46948] (2 species)
  7. 1752108Species Escherichia coli [TaxId:562] [158360] (26 PDB entries)
    Uniprot P0A7S9 1-114
  8. 1752134Domain d2gy9m1: 2gy9 M:1-114 [145235]
    Other proteins in same PDB: d2gy9b1, d2gy9d1, d2gy9h1, d2gy9i1, d2gy9p1, d2gy9q1, d2gy9s1, d2gy9t1

Details for d2gy9m1

PDB Entry: 2gy9 (more details), 15 Å

PDB Description: Structure of the 30S subunit of a pre-translocational E. coli ribosome obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1056
PDB Compounds: (M:) 30S ribosomal subunit protein S13

SCOPe Domain Sequences for d2gy9m1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gy9m1 a.156.1.1 (M:1-114) Ribosomal protein S13 {Escherichia coli [TaxId: 562]}
ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkp

SCOPe Domain Coordinates for d2gy9m1:

Click to download the PDB-style file with coordinates for d2gy9m1.
(The format of our PDB-style files is described here.)

Timeline for d2gy9m1: