Lineage for d2gwfb1 (2gwf B:197-317)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011327Fold d.345: NRDP1 C-terminal domain-like [160087] (1 superfamily)
    alpha-beta-alpha(3)-beta(3); a pseudo barrel beta-sheet of an SH3-like topology, surrounded by helices
  4. 3011328Superfamily d.345.1: NRDP1 C-terminal domain-like [160088] (1 family) (S)
    automatically mapped to Pfam PF08941
  5. 3011329Family d.345.1.1: USP8 interacting domain [160089] (1 protein)
    Pfam PF08941
  6. 3011330Protein E3 ubiquitin-protein ligase NRDP1 [160090] (1 species)
    RING finger protein 41
  7. 3011331Species Human (Homo sapiens) [TaxId:9606] [160091] (3 PDB entries)
    Uniprot Q9H4P4 193-317! Uniprot Q9H4P4 197-317
  8. 3011333Domain d2gwfb1: 2gwf B:197-317 [145229]
    Other proteins in same PDB: d2gwfa2, d2gwfa3, d2gwfc2, d2gwfc3, d2gwfd3, d2gwfe2, d2gwfe3

Details for d2gwfb1

PDB Entry: 2gwf (more details), 2.3 Å

PDB Description: Structure of a USP8-NRDP1 complex
PDB Compounds: (B:) RING finger protein 41

SCOPe Domain Sequences for d2gwfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gwfb1 d.345.1.1 (B:197-317) E3 ubiquitin-protein ligase NRDP1 {Human (Homo sapiens) [TaxId: 9606]}
neilewvnslqparvtrwggmistpdavlqavikrslvesgcpasivnelienaherswp
qglatletrqmnrryyenyvakripgkqavvvmacenqhmgddmvqepglvmifahgvee
i

SCOPe Domain Coordinates for d2gwfb1:

Click to download the PDB-style file with coordinates for d2gwfb1.
(The format of our PDB-style files is described here.)

Timeline for d2gwfb1: