Lineage for d2gsih1 (2gsi H:2-114)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740181Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (30 PDB entries)
    SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)
  8. 2740217Domain d2gsih1: 2gsi H:2-114 [145227]
    Other proteins in same PDB: d2gsia1, d2gsia2, d2gsib2, d2gsic1, d2gsic2, d2gsid2, d2gsie1, d2gsie2, d2gsif2, d2gsig1, d2gsig2, d2gsih2
    automatically matched to 2GSI B:2-114
    complexed with na

Details for d2gsih1

PDB Entry: 2gsi (more details), 2.81 Å

PDB Description: crystal structure of a murine fab in complex with an 11 residue peptide derived from staphylococcal nuclease
PDB Compounds: (H:) Immunoglobulin (gamma) heavy chain (VH + CH1 fragment)

SCOPe Domain Sequences for d2gsih1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsih1 b.1.1.1 (H:2-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
vqlqqsgaelvrsgasvklsctasgfnikdyymywvklrpeqglewigwidpengdteyv
ptfqgkvtmtadtssntaylqlssltsedtavyycnagvitmmgyqamdywgqgttvtts
sa

SCOPe Domain Coordinates for d2gsih1:

Click to download the PDB-style file with coordinates for d2gsih1.
(The format of our PDB-style files is described here.)

Timeline for d2gsih1: