Lineage for d2gsib2 (2gsi B:115-228)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747669Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2747968Species Mouse (Mus musculus) [TaxId:10090] [88576] (391 PDB entries)
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
  8. 2748390Domain d2gsib2: 2gsi B:115-228 [145222]
    Other proteins in same PDB: d2gsia1, d2gsia2, d2gsib1, d2gsic1, d2gsic2, d2gsid1, d2gsie1, d2gsie2, d2gsif1, d2gsig1, d2gsig2, d2gsih1
    complexed with na

Details for d2gsib2

PDB Entry: 2gsi (more details), 2.81 Å

PDB Description: crystal structure of a murine fab in complex with an 11 residue peptide derived from staphylococcal nuclease
PDB Compounds: (B:) Immunoglobulin (gamma) heavy chain (VH + CH1 fragment)

SCOPe Domain Sequences for d2gsib2:

Sequence, based on SEQRES records: (download)

>d2gsib2 b.1.1.2 (B:115-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
kttppsvyplapgtaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpsstwpsqtvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d2gsib2 b.1.1.2 (B:115-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
kttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
tvpsstwpsqtvtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d2gsib2:

Click to download the PDB-style file with coordinates for d2gsib2.
(The format of our PDB-style files is described here.)

Timeline for d2gsib2: