![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId:4932] [64239] (5 PDB entries) |
![]() | Domain d2gmia1: 2gmi A:1-152 [145218] Other proteins in same PDB: d2gmic_ |
PDB Entry: 2gmi (more details), 2.5 Å
SCOPe Domain Sequences for d2gmia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gmia1 d.20.1.1 (A:1-152) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} maslpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpd dypmeapkvrfltkiyhpnidrlgrisldvlktnwspalqirtvllsiqallaspnpndp landvaedwikneqgakakarewtklyakkkp
Timeline for d2gmia1: