Lineage for d2gk1g2 (2gk1 G:23-166)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183652Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2184852Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2184853Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 protein domains)
    family GH20
  6. 2184860Protein beta-hexosaminidase A [160560] (1 species)
  7. 2184861Species Human (Homo sapiens) [TaxId:9606] [160561] (2 PDB entries)
    Uniprot P06865 23-166
  8. 2184869Domain d2gk1g2: 2gk1 G:23-166 [145217]
    Other proteins in same PDB: d2gk1a1, d2gk1b1, d2gk1b2, d2gk1c1, d2gk1d1, d2gk1d2, d2gk1e1, d2gk1f1, d2gk1f2, d2gk1g1, d2gk1h1, d2gk1h2
    automatically matched to 2GJX A:23-166
    complexed with ngt

Details for d2gk1g2

PDB Entry: 2gk1 (more details), 3.25 Å

PDB Description: x-ray crystal structure of ngt-bound hexa
PDB Compounds: (G:) Beta-hexosaminidase alpha chain

SCOPe Domain Sequences for d2gk1g2:

Sequence, based on SEQRES records: (download)

>d2gk1g2 d.92.2.1 (G:23-166) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]}
lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgsgswprpy
ltgkrhtleknvlvvsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletf
sqlvwksaegtffinkteiedfpr

Sequence, based on observed residues (ATOM records): (download)

>d2gk1g2 d.92.2.1 (G:23-166) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]}
lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgtleknvlv
vsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletfsqlvwksaegtffi
nkteiedfpr

SCOPe Domain Coordinates for d2gk1g2:

Click to download the PDB-style file with coordinates for d2gk1g2.
(The format of our PDB-style files is described here.)

Timeline for d2gk1g2: