SCOPe 2.06: Domain d2gk1g2: 2gk1 G:23-166

Lineage for d2gk1g2 (2gk1 G:23-166)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins)
   family GH20

6. Protein beta-hexosaminidase A [160560] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [160561] (2 PDB entries)
   Uniprot P06865 23-166

8. Domain d2gk1g2: 2gk1 G:23-166 [145217]
   Other proteins in same PDB: d2gk1a1, d2gk1b1, d2gk1b2, d2gk1c1, d2gk1d1, d2gk1d2, d2gk1e1, d2gk1f1, d2gk1f2, d2gk1g1, d2gk1h1, d2gk1h2
   automatically matched to 2GJX A:23-166
   complexed with ngt

Details for d2gk1g2

PDB Entry: 2gk1, 3.25 Å

PDB Description: x-ray crystal structure of ngt-bound hexa

PDB Compounds: (G:) Beta-hexosaminidase alpha chain

SCOPe Domain Sequences for d2gk1g2:

Sequence, based on SEQRES records:

>d2gk1g2 d.92.2.1 (G:23-166) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]}
lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgsgswprpy
ltgkrhtleknvlvvsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletf
sqlvwksaegtffinkteiedfpr

Sequence, based on observed residues (ATOM records):

>d2gk1g2 d.92.2.1 (G:23-166) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]}
lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgtleknvlv
vsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletfsqlvwksaegtffi
nkteiedfpr

Timeline for d2gk1g2:

• d2gk1g2 first appeared in SCOP 1.75
  
• d2gk1g2 appears in SCOPe 2.05
  
• d2gk1g2 does not appear in SCOPe 2.07