Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 proteins) Glycosyl hydrolase family 20, GH20 automatically mapped to Pfam PF00728 |
Protein beta-hexosaminidase A [159387] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [159388] (2 PDB entries) Uniprot P06865 167-528 |
Domain d2gk1g1: 2gk1 G:167-528 [145216] Other proteins in same PDB: d2gk1a2, d2gk1b1, d2gk1b2, d2gk1c2, d2gk1d1, d2gk1d2, d2gk1e2, d2gk1f1, d2gk1f2, d2gk1g2, d2gk1h1, d2gk1h2 automatically matched to 2GJX A:167-528 complexed with ngt |
PDB Entry: 2gk1 (more details), 3.25 Å
SCOPe Domain Sequences for d2gk1g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gk1g1 c.1.8.6 (G:167-528) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]} fphrgllldtsrhylplssildtldvmaynklnvfhwhlvddpsfpyesftfpelmrkgs ynpvthiytaqdvkevieyarlrgirvlaefdtpghtlswgpgipglltpcysgsepsgt fgpvnpslnntyefmstfflevssvfpdfylhlggdevdftcwksnpeiqdfmrkkgfge dfkqlesfyiqtlldivssygkgyvvwqevfdnkvkiqpdtiiqvwredipvnymkelel vtkagfrallsapwylnrisygpdwkdfyvveplafegtpeqkalviggeacmwgeyvdn tnlvprlwpragavaerlwsnkltsdltfayerlshfrcellrrgvqaqplnvgfceqef eq
Timeline for d2gk1g1: