Lineage for d2gk1e2 (2gk1 E:23-166)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917420Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1918601Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 1918602Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins)
    family GH20
  6. 1918609Protein beta-hexosaminidase A [160560] (1 species)
  7. 1918610Species Human (Homo sapiens) [TaxId:9606] [160561] (2 PDB entries)
    Uniprot P06865 23-166
  8. 1918617Domain d2gk1e2: 2gk1 E:23-166 [145215]
    Other proteins in same PDB: d2gk1a1, d2gk1b1, d2gk1b2, d2gk1c1, d2gk1d1, d2gk1d2, d2gk1e1, d2gk1f1, d2gk1f2, d2gk1g1, d2gk1h1, d2gk1h2
    automatically matched to 2GJX A:23-166
    complexed with ngt

Details for d2gk1e2

PDB Entry: 2gk1 (more details), 3.25 Å

PDB Description: x-ray crystal structure of ngt-bound hexa
PDB Compounds: (E:) Beta-hexosaminidase alpha chain

SCOPe Domain Sequences for d2gk1e2:

Sequence, based on SEQRES records: (download)

>d2gk1e2 d.92.2.1 (E:23-166) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]}
lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgsgswprpy
ltgkrhtleknvlvvsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletf
sqlvwksaegtffinkteiedfpr

Sequence, based on observed residues (ATOM records): (download)

>d2gk1e2 d.92.2.1 (E:23-166) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]}
lwpwpqnfqtsdqryvlypnnfqfqydvssaaqpgcsvldeafqryrdllfgtleknvlv
vsvvtpgcnqlptlesvenytltinddqclllsetvwgalrgletfsqlvwksaegtffi
nkteiedfpr

SCOPe Domain Coordinates for d2gk1e2:

Click to download the PDB-style file with coordinates for d2gk1e2.
(The format of our PDB-style files is described here.)

Timeline for d2gk1e2: