Lineage for d2gjxe1 (2gjx E:167-528)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 816656Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (5 proteins)
    Glycosyl hydrolase family 20, GH20
  6. 816663Protein beta-hexosaminidase A [159387] (1 species)
  7. 816664Species Human (Homo sapiens) [TaxId:9606] [159388] (2 PDB entries)
    Uniprot P06865 167-528
  8. 816667Domain d2gjxe1: 2gjx E:167-528 [145206]
    Other proteins in same PDB: d2gjxa2, d2gjxb1, d2gjxb2, d2gjxc1, d2gjxc2, d2gjxd2, d2gjxe2, d2gjxf1, d2gjxf2, d2gjxg1, d2gjxg2, d2gjxh2
    automatically matched to 2GJX A:167-528
    complexed with bma, nag, ndg, so4

Details for d2gjxe1

PDB Entry: 2gjx (more details), 2.8 Å

PDB Description: crystallographic structure of human beta-hexosaminidase a
PDB Compounds: (E:) Beta-hexosaminidase alpha chain

SCOP Domain Sequences for d2gjxe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gjxe1 c.1.8.6 (E:167-528) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]}
fphrgllldtsrhylplssildtldvmaynklnvfhwhlvddpsfpyesftfpelmrkgs
ynpvthiytaqdvkevieyarlrgirvlaefdtpghtlswgpgipglltpcysgsepsgt
fgpvnpslnntyefmstfflevssvfpdfylhlggdevdftcwksnpeiqdfmrkkgfge
dfkqlesfyiqtlldivssygkgyvvwqevfdnkvkiqpdtiiqvwredipvnymkelel
vtkagfrallsapwylnrisygpdwkdfyvveplafegtpeqkalviggeacmwgeyvdn
tnlvprlwpragavaerlwsnkltsdltfayerlshfrcellrrgvqaqplnvgfceqef
eq

SCOP Domain Coordinates for d2gjxe1:

Click to download the PDB-style file with coordinates for d2gjxe1.
(The format of our PDB-style files is described here.)

Timeline for d2gjxe1: