SCOPe 2.08: Domain d2gjxd1: 2gjx D:167-528

Lineage for d2gjxd1 (2gjx D:167-528)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 proteins)
   Glycosyl hydrolase family 20, GH20
   automatically mapped to Pfam PF00728

6. Protein beta-hexosaminidase A [159387] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159388] (2 PDB entries)
   Uniprot P06865 167-528

8. Domain d2gjxd1: 2gjx D:167-528 [145204]
   Other proteins in same PDB: d2gjxa2, d2gjxb1, d2gjxb2, d2gjxc1, d2gjxc2, d2gjxd2, d2gjxe2, d2gjxf1, d2gjxf2, d2gjxg1, d2gjxg2, d2gjxh2
   automated match to d2gjxa1
   complexed with nag, so4

Details for d2gjxd1

PDB Entry: 2gjx, 2.8 Å

PDB Description: crystallographic structure of human beta-hexosaminidase a

PDB Compounds: (D:) Beta-hexosaminidase alpha chain

SCOPe Domain Sequences for d2gjxd1:

Sequence; same for both SEQRES and ATOM records:

>d2gjxd1 c.1.8.6 (D:167-528) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]}
fphrgllldtsrhylplssildtldvmaynklnvfhwhlvddpsfpyesftfpelmrkgs
ynpvthiytaqdvkevieyarlrgirvlaefdtpghtlswgpgipglltpcysgsepsgt
fgpvnpslnntyefmstfflevssvfpdfylhlggdevdftcwksnpeiqdfmrkkgfge
dfkqlesfyiqtlldivssygkgyvvwqevfdnkvkiqpdtiiqvwredipvnymkelel
vtkagfrallsapwylnrisygpdwkdfyvveplafegtpeqkalviggeacmwgeyvdn
tnlvprlwpragavaerlwsnkltsdltfayerlshfrcellrrgvqaqplnvgfceqef
eq

Timeline for d2gjxd1:

• d2gjxd1 first appeared in SCOP 1.75
  
• d2gjxd1 appears in SCOPe 2.07