Lineage for d2ghwd2 (2ghw D:1-117)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2352672Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2352857Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (35 PDB entries)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
  8. 2352875Domain d2ghwd2: 2ghw D:1-117 [145201]
    Other proteins in same PDB: d2ghwa_, d2ghwb1, d2ghwc_, d2ghwd1
    automated match to d2ghwb2
    complexed with cl

Details for d2ghwd2

PDB Entry: 2ghw (more details), 2.3 Å

PDB Description: Crystal structure of SARS spike protein receptor binding domain in complex with a neutralizing antibody, 80R
PDB Compounds: (D:) anti-sars scFv antibody, 80R

SCOPe Domain Sequences for d2ghwd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ghwd2 b.1.1.1 (D:1-117) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
evqlvqsgggvvqpgkslrlscaasgfafssyamhwvrqapgkglewvavisydgsnkyy
adsvkgrftisrdnskntlylqmnslraedtavyycardrsyyldywgqgtlvtvss

SCOPe Domain Coordinates for d2ghwd2:

Click to download the PDB-style file with coordinates for d2ghwd2.
(The format of our PDB-style files is described here.)

Timeline for d2ghwd2: