Lineage for d2ghwb1 (2ghw B:132-240)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1104358Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (15 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1104490Species Human (Homo sapiens), cluster 3.1 [TaxId:9606] [88522] (8 PDB entries)
  8. 1104499Domain d2ghwb1: 2ghw B:132-240 [145198]
    Other proteins in same PDB: d2ghwa_, d2ghwb2, d2ghwc_, d2ghwd2
    complexed with cl

Details for d2ghwb1

PDB Entry: 2ghw (more details), 2.3 Å

PDB Description: Crystal structure of SARS spike protein receptor binding domain in complex with a neutralizing antibody, 80R
PDB Compounds: (B:) anti-sars scFv antibody, 80R

SCOPe Domain Sequences for d2ghwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ghwb1 b.1.1.1 (B:132-240) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.1 [TaxId: 9606]}
settltqspatlslspgeratlscrasqsvrsnlawyqqkpgqaprpliydastratgip
drfsgsgsgtdftltisrlepedfavyycqqrsnwpptfgqgtkvevks

SCOPe Domain Coordinates for d2ghwb1:

Click to download the PDB-style file with coordinates for d2ghwb1.
(The format of our PDB-style files is described here.)

Timeline for d2ghwb1: