Lineage for d2ghoc1 (2gho C:1-1114)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574252Family e.29.1.1: RNA-polymerase beta [64485] (4 proteins)
  6. 2574291Protein RNA-polymerase beta [64488] (2 species)
  7. 2574292Species Thermus aquaticus [TaxId:271] [64489] (4 PDB entries)
  8. 2574296Domain d2ghoc1: 2gho C:1-1114 [145196]
    Other proteins in same PDB: d2ghoa1, d2ghoa2, d2ghob1, d2ghob2, d2ghod1
    automatically matched to 1YNJ C:1-1114
    protein/RNA complex

Details for d2ghoc1

PDB Entry: 2gho (more details), 5 Å

PDB Description: recombinant thermus aquaticus rna polymerase for structural studies
PDB Compounds: (C:) DNA-directed RNA polymerase subunit beta

SCOPe Domain Sequences for d2ghoc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ghoc1 e.29.1.1 (C:1-1114) RNA-polymerase beta {Thermus aquaticus [TaxId: 271]}
meikrfgrireviplpplteiqvesykkalqadvppekrenvgiqaafketfpieegdkg
kgglvldfleyrigdppfsqdecrekdltyqaplyarlqlihkdtglikedevflghlpl
mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidleveasg
vvtmkvnkrkfplvlllrvlgydqetlvrelsaygdlvqglldeavlamrpeeamvrlft
llrpgdppkkdkalaylfglladpkrydlgeagrykaeeklgvglsgrtlvrfedgefkd
evflptlrylfaltagvpghevddidhlgnrrirtvgelmadqfrvglarlargvrermv
mgspdtltpaklvnsrpleaalreffsrsqlsqfkdetnplsslrhkrrisalgpggltr
eragfdvrdvhrthygricpvetpeganiglitslaayarvdalgfirtpyrrvkngvvt
eevvymtaseedrytiaqantplegdriatdrvvarrrgepvivapeevefmdvspkqvf
slntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
gevvkvdgtriavryedgrlvehplrryarsnqgtafdqrprvrvgqrvkkgdlladgpa
seegflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
ritrdiphlseaalrdldeegivrigaevkpgdilvgrtsfkgeqepspeerllrsifge
kardvkdtslrvppgeggivvgrlrlrrgdpgvelkpgvrevvrvfvaqkrklqvgdkla
nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
yispvfdgatepeikellaeafnlyfgkrqgegfgvdkrekevlaraeklglvspgkspe
eqlkelfdlgkvvlydgrtgepfegpivvgqmfimklyhmvedkmharstgpyslitqqp
lggkaqfggqrfgemevwaleaygaahtlqemltiksddiegrnaayqaiikgedvpeps
vpesfrvlvkelqalaldvqtldekdnpvdifeg

SCOPe Domain Coordinates for d2ghoc1:

Click to download the PDB-style file with coordinates for d2ghoc1.
(The format of our PDB-style files is described here.)

Timeline for d2ghoc1: