Lineage for d2gd4i1 (2gd4 I:5-431)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568174Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. 2568175Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. 2568176Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. 2568188Protein Antithrombin [56584] (2 species)
  7. 2568192Species Human (Homo sapiens) [TaxId:9606] [56586] (27 PDB entries)
    Uniprot P01008
  8. 2568243Domain d2gd4i1: 2gd4 I:5-431 [145195]
    Other proteins in same PDB: d2gd4a1, d2gd4b1, d2gd4h1, d2gd4l1
    automatically matched to 2GD4 C:4-431
    complexed with bma, ca, man, nag, nto

Details for d2gd4i1

PDB Entry: 2gd4 (more details), 3.3 Å

PDB Description: crystal structure of the antithrombin-s195a factor xa-pentasaccharide complex
PDB Compounds: (I:) antithrombin-III

SCOPe Domain Sequences for d2gd4i1:

Sequence, based on SEQRES records: (download)

>d2gd4i1 e.1.1.1 (I:5-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]}
vdictakprdipmnpmciyrspekkatedegseqkipeatnrrvwelskansrfattfyq
hladskndndniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqihfffa
klncrlyrkankasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenaeqsra
ainkwvsnktegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfykadg
escsasmmyqegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekeltpevl
qewldeleemmlvvhmprfriedgfslkeqlqdmglvdlfspaasalpgivaegrddlyv
sdafhkaflevneegseaaastavviagrslnpnrvtfkanrpflvfirevplntiifmg
rvanpcv

Sequence, based on observed residues (ATOM records): (download)

>d2gd4i1 e.1.1.1 (I:5-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]}
vdictakprdipmnpmciyrspeqkipeatnrrvwelskansrfattfyqhladskndnd
niflsplsistafamtklgacndtlqqlmevfkfdtisektsdqihfffaklncrlyrka
nkasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenaeqsraainkwvsnkt
egritdvipseaineltvlvlvntiyfkglwkskfspentrkelfykadgescsasmmyq
egkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekeltpevlqewldeleem
mlvvhmprfriedgfslkeqlqdmglvdlfspaasalpgivaegrddlyvsdafhkafle
vneegseaaastavviagrslnpnrvtfkanrpflvfirevplntiifmgrvanpcv

SCOPe Domain Coordinates for d2gd4i1:

Click to download the PDB-style file with coordinates for d2gd4i1.
(The format of our PDB-style files is described here.)

Timeline for d2gd4i1: