SCOPe 2.01: Domain d2gd4b1: 2gd4 B:16-249

Lineage for d2gd4b1 (2gd4 B:16-249)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Coagulation factor Xa, protease domain [50574] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50575] (43 PDB entries)
   Uniprot P00742 235-467

8. Domain d2gd4b1: 2gd4 B:16-249 [145192]
   Other proteins in same PDB: d2gd4a1, d2gd4c1, d2gd4i1, d2gd4l1
   complexed with ca, nag, nto

Details for d2gd4b1

PDB Entry: 2gd4, 3.3 Å

PDB Description: crystal structure of the antithrombin-s195a factor xa-pentasaccharide complex

PDB Compounds: (B:) Coagulation factor, Stuart factor, Stuart-Prower factor, Contains: Factor X light chain; Factor X heavy chain; Activated factor Xa heavy chain

SCOPe Domain Sequences for d2gd4b1:

Sequence; same for both SEQRES and ATOM records:

>d2gd4b1 b.47.1.2 (B:16-249) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte
qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm
tqktgivsgfgrthekgrqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda
cqgdaggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmktrglpk

Timeline for d2gd4b1:

• d2gd4b1 first appeared in SCOP 1.75
  
• d2gd4b1 appears in SCOPe 2.02
  
• d2gd4b1 appears in the current release, SCOPe 2.08