Lineage for d2ga9d1 (2ga9 D:12-479)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2626297Fold e.69: Poly(A) polymerase catalytic subunit-like [160956] (1 superfamily)
    3 domains; d1: all-alpha, contains HhH motif; d2: alpha+beta of nucleotidyltransferase fold (81302); d3: [alpha+beta; beta(3)-alpha-beta(3)-alpha(2); 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 123654, strands 2 and 5 are antiparallel to the rest
  4. 2626298Superfamily e.69.1: Poly(A) polymerase catalytic subunit-like [160957] (1 family) (S)
    Central domain d2 is distantly related to the nucleotidyltransferase superfamily (81301)
  5. 2626299Family e.69.1.1: Poxvirus poly(A) polymerase catalytic subunit-like [160958] (2 proteins)
    Pfam PF03296
  6. 2626300Protein Poly(A) polymerase catalytic subunit, PAPL [160959] (1 species)
  7. 2626301Species Vaccinia virus [TaxId:10245] [160960] (2 PDB entries)
    Uniprot P23371 12-479
  8. 2626303Domain d2ga9d1: 2ga9 D:12-479 [145190]
    Other proteins in same PDB: d2ga9a_
    complexed with ags, ca

Details for d2ga9d1

PDB Entry: 2ga9 (more details), 2.3 Å

PDB Description: crystal structure of the heterodimeric vaccinia virus polyadenylate polymerase with bound atp-gamma-s
PDB Compounds: (D:) Poly(A) polymerase catalytic subunit

SCOPe Domain Sequences for d2ga9d1:

Sequence, based on SEQRES records: (download)

>d2ga9d1 e.69.1.1 (D:12-479) Poly(A) polymerase catalytic subunit, PAPL {Vaccinia virus [TaxId: 10245]}
nitlkiietylgrvpsvneyhmlksqarniqkitvfnkdifvslvkknkkrffsdvntsa
seikdrilsyfskqtqtynigklftiielqsvlvttytdilgvltikapnvisskisynv
tsmeelardmlnsmnvavidkakvmgrhnvsslvknvnklmeeylrrhnkscicygsysl
ylinpnirygdidilqtnsrtflidlaflikfitgnniilskipylrnymvikdendnhi
idsfnirqdtmnvvpkifidniyivdptfqllnmikmfsqidrledlskdpekfnarmat
mleyvrythgivfdgkrnnmpmkciidennrivtvttkdyfsfkkclvyldenvlssdil
dlnadtscdfesvtnsvylihdnimytyfsntillsdkgkvheisarglcahillyqmlt
sgeykqclsdllnsmmnrdkipiyshterdkkpgrhgfiniekdiivf

Sequence, based on observed residues (ATOM records): (download)

>d2ga9d1 e.69.1.1 (D:12-479) Poly(A) polymerase catalytic subunit, PAPL {Vaccinia virus [TaxId: 10245]}
nitlkiietylgrvpsvneyhmlksqarniqkitvfnkdifvslvkknkkrffsdvntsa
seikdrilsyfskqtqtynigklftiielqsvlvttytdilgvltinvtsmeelardmln
smnvavvsslvknvnklmeeylrrhnkscicygsyslylinpnirygdidilqtnsrtfl
idlaflikfitgnniilskipylrnymvikdendnhiidsfnirqdtmnvvpkifidniy
ivdptfqllnmikmfsqidrledlskdpekfnarmatmleyvrythgivfdgkrnnmpmk
ciidennrivtvttkdyfsfkkclvyldenvlssdildlnadtscdfesvtnsvylihdn
imytyfsntillsdkgkvheisarglcahillyqmltsgeykqclsdllnsmmnrdkipi
yshterdkkpgrhgfiniekdiivf

SCOPe Domain Coordinates for d2ga9d1:

Click to download the PDB-style file with coordinates for d2ga9d1.
(The format of our PDB-style files is described here.)

Timeline for d2ga9d1: