SCOPe 2.06: Domain d2g9hd1: 2g9h D:4-86

Lineage for d2g9hd1 (2g9h D:4-86)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Enterotoxin type I, SEI [159080] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [159081] (1 PDB entry)
   Uniprot Q52T95 4-86

8. Domain d2g9hd1: 2g9h D:4-86 [145188]
   Other proteins in same PDB: d2g9ha1, d2g9ha2, d2g9hb1, d2g9hb2, d2g9hd2
   complexed with dio, epe, so4, zn

Details for d2g9hd1

PDB Entry: 2g9h, 2 Å

PDB Description: crystal structure of staphylococcal enterotoxin i (sei) in complex with a human mhc class ii molecule

PDB Compounds: (D:) extracellular enterotoxin type I

SCOPe Domain Sequences for d2g9hd1:

Sequence; same for both SEQRES and ATOM records:

>d2g9hd1 b.40.2.2 (D:4-86) Enterotoxin type I, SEI {Staphylococcus aureus [TaxId: 1280]}
igvgnlrnfytkhdyidlkglidknlpsanqlefstgindlisesnnwdeiskfkgkkld
ifgidyngpckskymyggatlsg

Timeline for d2g9hd1:

• d2g9hd1 first appeared in SCOP 1.75
  
• d2g9hd1 appears in SCOPe 2.05
  
• d2g9hd1 appears in the current release, SCOPe 2.07