Lineage for d2g81i1 (2g81 I:17-72)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258855Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) (S)
  5. 2258856Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)
  6. 2258857Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
    duplication: consists of two sequence repeats each having this fold
  7. 2258863Species Cowpea (Vigna unguiculata) [TaxId:3917] [161126] (2 PDB entries)
    Uniprot P17734 17-72! Uniprot Q84X88 44-100
  8. 2258864Domain d2g81i1: 2g81 I:17-72 [145187]
    Other proteins in same PDB: d2g81e_
    complexed with acy, ca, edo, p6g, pge, so4

Details for d2g81i1

PDB Entry: 2g81 (more details), 1.55 Å

PDB Description: Crystal Structure of the Bowman-Birk Inhibitor from Vigna unguiculata Seeds in Complex with Beta-trypsin at 1.55 Angstrons Resolution
PDB Compounds: (I:) Bowman-Birk type seed trypsin and chymotrypsin inhibitor

SCOPe Domain Sequences for d2g81i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g81i1 g.3.13.1 (I:17-72) Bowman-Birk inhibitor, BBI {Cowpea (Vigna unguiculata) [TaxId: 3917]}
pccdrcectksippqcrcsdvrlnschsackscactfsipaqcfcgdindfcykpc

SCOPe Domain Coordinates for d2g81i1:

Click to download the PDB-style file with coordinates for d2g81i1.
(The format of our PDB-style files is described here.)

Timeline for d2g81i1: