Lineage for d2g77b1 (2g77 B:30-202)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2475538Protein Rab-33b [142279] (1 species)
  7. 2475539Species Mouse (Mus musculus) [TaxId:10090] [142280] (2 PDB entries)
    Uniprot O35963 32-196
  8. 2475541Domain d2g77b1: 2g77 B:30-202 [145186]
    Other proteins in same PDB: d2g77a1, d2g77a2
    complexed with af3, gdp, mg

Details for d2g77b1

PDB Entry: 2g77 (more details), 2.26 Å

PDB Description: crystal structure of gyp1 tbc domain in complex with rab33 gtpase bound to gdp and alf3
PDB Compounds: (B:) Ras-related protein Rab-33B

SCOPe Domain Sequences for d2g77b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g77b1 c.37.1.8 (B:30-202) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]}
rsrifkiivigdsnvgktcltyrfcagrfpdrteatigvdfreravdidgerikiqlwdt
agqerfrksmvqhyyrnvhavvfvydmtnmasfhslpawieeckqhllandiprilvgnk
cdlrsaiqvptdlaqkfadthsmplfetsaknpndndhveaifmtlahklksh

SCOPe Domain Coordinates for d2g77b1:

Click to download the PDB-style file with coordinates for d2g77b1.
(The format of our PDB-style files is described here.)

Timeline for d2g77b1: