SCOPe 2.01: Domain d2g77b1: 2g77 B:30-202

Lineage for d2g77b1 (2g77 B:30-202)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab-33b [142279] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [142280] (2 PDB entries)
   Uniprot O35963 32-196

8. Domain d2g77b1: 2g77 B:30-202 [145186]
   Other proteins in same PDB: d2g77a1, d2g77a2
   complexed with af3, gdp, mg

Details for d2g77b1

PDB Entry: 2g77, 2.26 Å

PDB Description: crystal structure of gyp1 tbc domain in complex with rab33 gtpase bound to gdp and alf3

PDB Compounds: (B:) Ras-related protein Rab-33B

SCOPe Domain Sequences for d2g77b1:

Sequence; same for both SEQRES and ATOM records:

>d2g77b1 c.37.1.8 (B:30-202) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]}
rsrifkiivigdsnvgktcltyrfcagrfpdrteatigvdfreravdidgerikiqlwdt
agqerfrksmvqhyyrnvhavvfvydmtnmasfhslpawieeckqhllandiprilvgnk
cdlrsaiqvptdlaqkfadthsmplfetsaknpndndhveaifmtlahklksh

Timeline for d2g77b1:

• d2g77b1 first appeared in SCOP 1.75
  
• d2g77b1 appears in SCOPe 2.02
  
• d2g77b1 appears in the current release, SCOPe 2.08