![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Rab-33b [142279] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [142280] (2 PDB entries) Uniprot O35963 32-196 |
![]() | Domain d2g77b1: 2g77 B:30-202 [145186] Other proteins in same PDB: d2g77a1, d2g77a2 complexed with af3, gdp, mg; mutant |
PDB Entry: 2g77 (more details), 2.26 Å
SCOP Domain Sequences for d2g77b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g77b1 c.37.1.8 (B:30-202) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} rsrifkiivigdsnvgktcltyrfcagrfpdrteatigvdfreravdidgerikiqlwdt agqerfrksmvqhyyrnvhavvfvydmtnmasfhslpawieeckqhllandiprilvgnk cdlrsaiqvptdlaqkfadthsmplfetsaknpndndhveaifmtlahklksh
Timeline for d2g77b1: