SCOP 1.75: Domain d2g45d1: 2g45 D:173-285

Lineage for d2g45d1 (2g45 D:173-285)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (6 families)

5. Family g.44.1.5: Zf-UBP [161204] (3 proteins)
   Pfam PF02148

6. Protein Ubiquitin carboxyl-terminal hydrolase 5, UBP5 [161207] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161208] (2 PDB entries)
   Uniprot P45974 169-285

8. Domain d2g45d1: 2g45 D:173-285 [145183]
   Other proteins in same PDB: d2g45b1, d2g45e1
   automatically matched to 2G43 A:8-124
   complexed with cl, zn

Details for d2g45d1

PDB Entry: 2g45, 1.99 Å

PDB Description: Co-crystal structure of znf ubp domain from the deubiquitinating enzyme isopeptidase T (isot) in complex with ubiquitin

PDB Compounds: (D:) Ubiquitin carboxyl-terminal hydrolase 5

SCOP Domain Sequences for d2g45d1:

Sequence; same for both SEQRES and ATOM records:

>d2g45d1 g.44.1.5 (D:173-285) Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Human (Homo sapiens) [TaxId: 9606]}
vrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsggnnh
avehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidmlk

Timeline for d2g45d1:

• d2g45d1 is new in SCOP 1.75
  
• d2g45d1 is called d2g45d_ in SCOPe 2.01
  
• d2g45d1 appears in the current release, SCOPe 2.08, called d2g45d_