SCOPe 2.04: Domain d2g45a_: 2g45 A:

Lineage for d2g45a_ (2g45 A:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.44: RING/U-box [57849] (1 superfamily)
   dimetal(zinc)-bound alpha+beta motif; structurally diverse

4. Superfamily g.44.1: RING/U-box [57850] (7 families)

5. Family g.44.1.5: Zf-UBP [161204] (4 proteins)
   Pfam PF02148

6. Protein Ubiquitin carboxyl-terminal hydrolase 5, UBP5 [161207] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161208] (2 PDB entries)
   Uniprot P45974 169-285

8. Domain d2g45a_: 2g45 A: [145182]
   Other proteins in same PDB: d2g45b_, d2g45e_
   automated match to d2g43a1
   complexed with cl, zn

Details for d2g45a_

PDB Entry: 2g45, 1.99 Å

PDB Description: Co-crystal structure of znf ubp domain from the deubiquitinating enzyme isopeptidase T (isot) in complex with ubiquitin

PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 5

SCOPe Domain Sequences for d2g45a_:

Sequence; same for both SEQRES and ATOM records:

>d2g45a_ g.44.1.5 (A:) Ubiquitin carboxyl-terminal hydrolase 5, UBP5 {Human (Homo sapiens) [TaxId: 9606]}
vrqvskhafslkqldnparippcgwkcskcdmrenlwlnltdgsilcgrryfdgsggnnh
avehyretgyplavklgtitpdgadvysydeddmvldpslaehlshfgidmlkmqkt

Timeline for d2g45a_:

• d2g45a_ first appeared in SCOP 1.75, called d2g45a1
  
• d2g45a_ appears in SCOPe 2.03
  
• d2g45a_ appears in SCOPe 2.05
  
• d2g45a_ appears in the current release, SCOPe 2.08