Lineage for d2g3qa1 (2g3q A:1339-1381)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 763589Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 763613Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 763614Family a.5.2.1: UBA domain [46935] (24 proteins)
  6. 763663Protein Endocytic protein Ede1, YBL047C [158358] (1 species)
  7. 763664Species Saccharomyces cerevisiae [TaxId:4932] [158359] (1 PDB entry)
    Uniprot P34216 1339-1381
  8. 763665Domain d2g3qa1: 2g3q A:1339-1381 [145181]
    Other proteins in same PDB: d2g3qb1

Details for d2g3qa1

PDB Entry: 2g3q (more details)

PDB Description: solution structure of ede1 uba-ubiquitin complex
PDB Compounds: (A:) Protein YBL047C

SCOP Domain Sequences for d2g3qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]}
ttpkslaveelsgmgfteeeahnalekcnwdleaatnflldsa

SCOP Domain Coordinates for d2g3qa1:

Click to download the PDB-style file with coordinates for d2g3qa1.
(The format of our PDB-style files is described here.)

Timeline for d2g3qa1:

763665
d2g3qa1 in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d2g3qb1