SCOPe 2.06: Domain d2g2wa1: 2g2w A:26-292

Lineage for d2g2wa1 (2g2w A:26-292)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Klebsiella pneumoniae, SHV-1 [TaxId:573] [56609] (27 PDB entries)
   inhibited by tazobactam
   Uniprot Q5PSW7 ! Uniprot P14557 22-286

8. Domain d2g2wa1: 2g2w A:26-292 [145180]
   Other proteins in same PDB: d2g2wb_

Details for d2g2wa1

PDB Entry: 2g2w, 1.8 Å

PDB Description: crystal structure of the shv d104k beta-lactamase/beta-lactamase inhibitor protein (blip) complex

PDB Compounds: (A:) Beta-lactamase SHV-1

SCOPe Domain Sequences for d2g2wa1:

Sequence; same for both SEQRES and ATOM records:

>d2g2wa1 e.3.1.1 (A:26-292) beta-Lactamase, class A {Klebsiella pneumoniae, SHV-1 [TaxId: 573]}
spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd
agdeqlerkihyrqqdlvkyspvsekhladgmtvgelcaaaitmsdnsaanlllatvggp
agltaflrqigdnvtrldrwetelnealpgdardtttpasmaatlrklltsqrlsarsqr
qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd
tpasmaernqqiagigaaliehwqr

Timeline for d2g2wa1:

• d2g2wa1 first appeared in SCOP 1.75
  
• d2g2wa1 appears in SCOPe 2.05
  
• d2g2wa1 appears in SCOPe 2.07
  
• d2g2wa1 appears in the current release, SCOPe 2.08