Lineage for d2fwoa2 (2fwo A:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2938188Species Mouse (Mus musculus), H-2KD [TaxId:10090] [160078] (4 PDB entries)
    Uniprot P01902 22-202
  8. 2938192Domain d2fwoa2: 2fwo A:1-181 [145178]
    Other proteins in same PDB: d2fwoa1, d2fwob_

Details for d2fwoa2

PDB Entry: 2fwo (more details), 2.6 Å

PDB Description: mhc class i h-2kd heavy chain in complex with beta-2microglobulin and peptide derived from influenza nucleoprotein
PDB Compounds: (A:) H-2 class I histocompatibility antigen, K-D alpha chain

SCOPe Domain Sequences for d2fwoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fwoa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KD [TaxId: 10090]}
gphslryfvtavsrpglgeprfiavgyvddtqfvrfdsdadnprfeprapwmeqegpeyw
eeqtqraksdeqwfrvslrtaqryynqskggshtfqrmfgcdvgsdwrllrgyqqfaydg
rdyialnedlktwtaadtaalitrrkweqagdaeyyraylegecvewlrrylelgnetll
r

SCOPe Domain Coordinates for d2fwoa2:

Click to download the PDB-style file with coordinates for d2fwoa2.
(The format of our PDB-style files is described here.)

Timeline for d2fwoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fwoa1
View in 3D
Domains from other chains:
(mouse over for more information)
d2fwob_