SCOPe 2.06: Domain d2fwoa1: 2fwo A:182-275

Lineage for d2fwoa1 (2fwo A:182-275)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (109 PDB entries)
   Uniprot P01901 22-299

8. Domain d2fwoa1: 2fwo A:182-275 [145177]
   Other proteins in same PDB: d2fwoa2, d2fwob_

Details for d2fwoa1

PDB Entry: 2fwo, 2.6 Å

PDB Description: mhc class i h-2kd heavy chain in complex with beta-2microglobulin and peptide derived from influenza nucleoprotein

PDB Compounds: (A:) H-2 class I histocompatibility antigen, K-D alpha chain

SCOPe Domain Sequences for d2fwoa1:

Sequence; same for both SEQRES and ATOM records:

>d2fwoa1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvtyhprsqvdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgtf
qkwaavvvplgkeqnytchvhhkglpepltlrwk

Timeline for d2fwoa1:

• d2fwoa1 first appeared in SCOP 1.75
  
• d2fwoa1 appears in SCOPe 2.05
  
• d2fwoa1 appears in SCOPe 2.07
  
• d2fwoa1 appears in the current release, SCOPe 2.08