![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class I MHC, alpha-3 domain [88604] (4 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries) Uniprot P01901 22-299 |
![]() | Domain d2fwoa1: 2fwo A:182-275 [145177] Other proteins in same PDB: d2fwoa2, d2fwob_ |
PDB Entry: 2fwo (more details), 2.6 Å
SCOPe Domain Sequences for d2fwoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fwoa1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvtyhprsqvdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgtf qkwaavvvplgkeqnytchvhhkglpepltlrwk
Timeline for d2fwoa1: