![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
![]() | Superfamily d.211.1: Ankyrin repeat [48403] (2 families) ![]() repeats organized in elongated structures |
![]() | Family d.211.1.1: Ankyrin repeat [48404] (18 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
![]() | Protein Lin-12 [160152] (1 species) |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [160153] (1 PDB entry) Uniprot P14585 1021-1297 |
![]() | Domain d2fo1e1: 2fo1 E:1021-1297 [145176] Other proteins in same PDB: d2fo1a1, d2fo1a2, d2fo1a3, d2fo1d1 protein/DNA complex |
PDB Entry: 2fo1 (more details), 3.12 Å
SCOPe Domain Sequences for d2fo1e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} espiklhteaagsyaitepitresvniidprhnrtvlhwiasnssaeksedlivheakec iaagadvnamdcdentplmlavlarrrrlvaylmkagadptiynksersalhqaaanrdf gmmvymlnstklkgdieeldrngmtalmivahnegrdqvasakllvekgakvdydgaark dsekykgrtalhyaaqvsnmpivkylvgekgsnkdkqdedgktpimlaaqegrievvmyl iqqgasveavdatdhtarqlaqannhhnivdifdrcr
Timeline for d2fo1e1:
![]() Domains from other chains: (mouse over for more information) d2fo1a1, d2fo1a2, d2fo1a3, d2fo1d1 |