SCOP 1.75: Domain d2fo1e1: 2fo1 E:1021-1297

Lineage for d2fo1e1 (2fo1 E:1021-1297)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (1 family)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (17 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein Lin-12 [160152] (1 species)

7. Species Caenorhabditis elegans [TaxId:6239] [160153] (1 PDB entry)
   Uniprot P14585 1021-1297

8. Domain d2fo1e1: 2fo1 E:1021-1297 [145176]
   Other proteins in same PDB: d2fo1a1, d2fo1a2, d2fo1a3, d2fo1d1

Details for d2fo1e1

PDB Entry: 2fo1, 3.12 Å

PDB Description: Crystal Structure of the CSL-Notch-Mastermind ternary complex bound to DNA

PDB Compounds: (E:) Lin-12 protein

SCOP Domain Sequences for d2fo1e1:

Sequence; same for both SEQRES and ATOM records:

>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]}
espiklhteaagsyaitepitresvniidprhnrtvlhwiasnssaeksedlivheakec
iaagadvnamdcdentplmlavlarrrrlvaylmkagadptiynksersalhqaaanrdf
gmmvymlnstklkgdieeldrngmtalmivahnegrdqvasakllvekgakvdydgaark
dsekykgrtalhyaaqvsnmpivkylvgekgsnkdkqdedgktpimlaaqegrievvmyl
iqqgasveavdatdhtarqlaqannhhnivdifdrcr

Timeline for d2fo1e1:

• d2fo1e1 is new in SCOP 1.75
  
• d2fo1e1 appears in SCOPe 2.01
  
• d2fo1e1 appears in the current release, SCOPe 2.08