Lineage for d2fo1d1 (2fo1 D:52-114)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925761Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 925960Superfamily a.137.14: Lag-3 N-terminal region [158851] (1 family) (S)
    long kinked helix, part of the CSL-Notch-Mastermind ternary complex
  5. 925961Family a.137.14.1: Lag-3 N-terminal region [158852] (1 protein)
  6. 925962Protein Abnormal cell lineage protein 3, Lag-3 [158853] (1 species)
  7. 925963Species Nematode (Caenorhabditis elegans) [TaxId:6239] [158854] (1 PDB entry)
    Uniprot Q09260 52-114
  8. 925964Domain d2fo1d1: 2fo1 D:52-114 [145175]
    Other proteins in same PDB: d2fo1a1, d2fo1a2, d2fo1a3, d2fo1e1
    protein/DNA complex

Details for d2fo1d1

PDB Entry: 2fo1 (more details), 3.12 Å

PDB Description: Crystal Structure of the CSL-Notch-Mastermind ternary complex bound to DNA
PDB Compounds: (D:) Protein lag-3

SCOPe Domain Sequences for d2fo1d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fo1d1 a.137.14.1 (D:52-114) Abnormal cell lineage protein 3, Lag-3 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
edeptigdlnafhsgeelhrqrselaranyekarpemianqravtahlfnrytedeerkr
veq

SCOPe Domain Coordinates for d2fo1d1:

Click to download the PDB-style file with coordinates for d2fo1d1.
(The format of our PDB-style files is described here.)

Timeline for d2fo1d1: