Lineage for d2fmme1 (2fmm E:9-124)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2352091Fold a.283: ENT-like [158638] (1 superfamily)
    5 helices, irregular array, right-handed superhelix
  4. 2352092Superfamily a.283.1: ENT-like [158639] (1 family) (S)
  5. 2352093Family a.283.1.1: Emsy N terminal (ENT) domain-like [158640] (2 proteins)
    Pfam PF03735
  6. 2352094Protein Emsy [158641] (1 species)
  7. 2352095Species Human (Homo sapiens) [TaxId:9606] [158642] (2 PDB entries)
    Uniprot Q7Z589 9-124! Uniprot Q8TE50 11-107
  8. 2352096Domain d2fmme1: 2fmm E:9-124 [145174]
    Other proteins in same PDB: d2fmma_, d2fmmb_, d2fmmc_, d2fmmd_, d2fmme2
    complexed with so4

Details for d2fmme1

PDB Entry: 2fmm (more details), 1.8 Å

PDB Description: Crystal Structure of EMSY-HP1 complex
PDB Compounds: (E:) Protein EMSY

SCOPe Domain Sequences for d2fmme1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fmme1 a.283.1.1 (E:9-124) Emsy {Human (Homo sapiens) [TaxId: 9606]}
ldlsrdeckrilrkleleayagvisalraqgdltkekkdllgelskvlsisterhraevr
ravnderlttiahnmsgpnsssewsiegrrlvplmprlvpqtaftvtanavanaai

SCOPe Domain Coordinates for d2fmme1:

Click to download the PDB-style file with coordinates for d2fmme1.
(The format of our PDB-style files is described here.)

Timeline for d2fmme1: