Lineage for d2fjub4 (2fju B:312-660)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089342Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2089343Family c.1.18.1: Mammalian PLC [51696] (2 protein domains)
  6. 2089367Protein Phospholipase C-beta-2 [159421] (1 species)
  7. 2089368Species Human (Homo sapiens) [TaxId:9606] [159422] (2 PDB entries)
    Uniprot Q00722 312-660
  8. 2089370Domain d2fjub4: 2fju B:312-660 [145173]
    Other proteins in same PDB: d2fjua_, d2fjub1, d2fjub2, d2fjub3
    complexed with ca, gsp, mg

Details for d2fjub4

PDB Entry: 2fju (more details), 2.2 Å

PDB Description: Activated Rac1 bound to its effector phospholipase C beta 2
PDB Compounds: (B:) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta 2

SCOPe Domain Sequences for d2fjub4:

Sequence, based on SEQRES records: (download)

>d2fjub4 c.1.18.1 (B:312-660) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}
hdmtqplnhyfinsshntyltagqfsglssaemyrqvllsgcrcveldcwkgkppdeepi
ithgftmttdiffkeaieaiaesafktspypiilsfenhvdsprqqakmaeycrtifgdm
llteplekfplkpgvplpspedlrgkiliknkknqfsgptssskdtggeaegssppsapa
vwageegteleeeeveeeeeeesgnldeeeikkmqsdegtaglevtayeemsslvnyiqp
tkfvsfefsaqknrsyvissftelkaydllskasvqfvdynkrqmsriypkgtrmdssny
mpqmfwnagcqmvalnfqtmdlpmqqnmavfefngqsgyllkhefmrrp

Sequence, based on observed residues (ATOM records): (download)

>d2fjub4 c.1.18.1 (B:312-660) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}
hdmtqplnhyfinsshntyltagqfsglssaemyrqvllsgcrcveldcwkgkppdeepi
ithgftmttdiffkeaieaiaesafktspypiilsfenhvdsprqqakmaeycrtifgdm
llteplekfplkpgvplpspedlrgkiliknkkeesgnldeeeikkmqsdegtaglevta
yeemsslvnyiqptkfvsfefsaqknrsyvissftelkaydllskasvqfvdynkrqmsr
iypkgtrmdssnympqmfwnagcqmvalnfqtmdlpmqqnmavfefngqsgyllkhefmr
rp

SCOPe Domain Coordinates for d2fjub4:

Click to download the PDB-style file with coordinates for d2fjub4.
(The format of our PDB-style files is described here.)

Timeline for d2fjub4: