![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
![]() | Protein Phospholipase C-beta-2 [159207] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [159208] (2 PDB entries) Uniprot Q00722 11-141 |
![]() | Domain d2fjub3: 2fju B:11-141 [145172] Other proteins in same PDB: d2fjua_, d2fjub1, d2fjub2, d2fjub4 complexed with ca, gsp, mg |
PDB Entry: 2fju (more details), 2.2 Å
SCOPe Domain Sequences for d2fjub3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjub3 b.55.1.1 (B:11-141) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} pkvkaylsqgerfikwddettvaspvilrvdpkgyylywtyqskemeflditsirdtrfg kfakmpksqklrdvfnmdfpdnsfllktltvvsgpdmvdltfhnfvsykenvgkawaedv lalvkhpltan
Timeline for d2fjub3: