Lineage for d2fjub3 (2fju B:11-141)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805150Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 805151Superfamily b.55.1: PH domain-like [50729] (13 families) (S)
  5. 805152Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (47 proteins)
    Pfam PF00169
  6. 805287Protein Phospholipase C-beta-2 [159207] (1 species)
  7. 805288Species Human (Homo sapiens) [TaxId:9606] [159208] (2 PDB entries)
    Uniprot Q00722 11-141
  8. 805290Domain d2fjub3: 2fju B:11-141 [145172]
    Other proteins in same PDB: d2fjua1, d2fjub1, d2fjub2, d2fjub4
    complexed with ca, gsp, mg

Details for d2fjub3

PDB Entry: 2fju (more details), 2.2 Å

PDB Description: Activated Rac1 bound to its effector phospholipase C beta 2
PDB Compounds: (B:) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta 2

SCOP Domain Sequences for d2fjub3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjub3 b.55.1.1 (B:11-141) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}
pkvkaylsqgerfikwddettvaspvilrvdpkgyylywtyqskemeflditsirdtrfg
kfakmpksqklrdvfnmdfpdnsfllktltvvsgpdmvdltfhnfvsykenvgkawaedv
lalvkhpltan

SCOP Domain Coordinates for d2fjub3:

Click to download the PDB-style file with coordinates for d2fjub3.
(The format of our PDB-style files is described here.)

Timeline for d2fjub3: