Class b: All beta proteins [48724] (180 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) two constituent families are related by circular permutation |
Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins) |
Protein Phospholipase C-beta-2 [158944] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158945] (2 PDB entries) Uniprot Q00722 678-799 |
Domain d2fjub2: 2fju B:678-799 [145171] Other proteins in same PDB: d2fjua_, d2fjub1, d2fjub3, d2fjub4 complexed with ca, gsp, mg |
PDB Entry: 2fju (more details), 2.2 Å
SCOPe Domain Sequences for d2fjub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjub2 b.7.1.1 (B:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} ttlsitvisgqflsersvrtyvevelfglpgdpkrryrtklspstnsinpvwkeepfvfe kilmpelaslrvavmeegnkflghriipinalnsgyhhlclhsesnmpltmpalfiflem kd
Timeline for d2fjub2: