Lineage for d2fjub2 (2fju B:678-799)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2772796Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)
  6. 2772898Protein Phospholipase C-beta-2 [158944] (1 species)
  7. 2772899Species Human (Homo sapiens) [TaxId:9606] [158945] (2 PDB entries)
    Uniprot Q00722 678-799
  8. 2772901Domain d2fjub2: 2fju B:678-799 [145171]
    Other proteins in same PDB: d2fjua_, d2fjub1, d2fjub3, d2fjub4
    complexed with ca, gsp, mg

Details for d2fjub2

PDB Entry: 2fju (more details), 2.2 Å

PDB Description: Activated Rac1 bound to its effector phospholipase C beta 2
PDB Compounds: (B:) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta 2

SCOPe Domain Sequences for d2fjub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjub2 b.7.1.1 (B:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]}
ttlsitvisgqflsersvrtyvevelfglpgdpkrryrtklspstnsinpvwkeepfvfe
kilmpelaslrvavmeegnkflghriipinalnsgyhhlclhsesnmpltmpalfiflem
kd

SCOPe Domain Coordinates for d2fjub2:

Click to download the PDB-style file with coordinates for d2fjub2.
(The format of our PDB-style files is described here.)

Timeline for d2fjub2: